PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462969148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 329aa    MW: 36263.6 Da    PI: 4.5898
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462969148genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-09257307353
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                 R +++k qle+Le+++ +++ p+ +++  + + ++L+ + +  WF  rR 
  462969148 257 ARKRLKKVQLETLERVYLRSKRPTNTMISSIVQVTNLPRNTIVKWFEDRRE 307
                58999********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.252252312IPR001356Homeobox domain
SMARTSM003892.5E-4254316IPR001356Homeobox domain
SuperFamilySSF466891.07E-9255309IPR009057Homeodomain-like
CDDcd000861.24E-8255306No hitNo description
PfamPF000463.0E-7257307IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.9E-9257307IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MATVLTLAVP AASAATTACI SGAPSPAPFA GTRAHLSLRF RCSPRGVACA LRRRPTKYKT  60
KIQNDDVAAE DDMDDEDEDA ALEAIFKQLE EDLENDDLSV GDDEISEEDM ARFEQELAEA  120
IGDVGGTEES AGDLSSGFGD SGNDDKEAGS EQSELKNWQL RRLARALKIG RRKTSIKNLA  180
SELGLDRALV IELLRNPPPK LLFMSDSLPD ETPSKPEVKE VELPSSVIVD EAEASHPTEI  240
SQEMELPIHV RSAEWSARKR LKKVQLETLE RVYLRSKRPT NTMISSIVQV TNLPRNTIVK  300
WFEDRREQDG VPDHHAAFKR SLSETVAGS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256264ARKRLKKVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008659724.11e-157PREDICTED: uncharacterized protein LOC103638651
TrEMBLA0A0A9IZX91e-159A0A0A9IZX9_ARUDO; Uncharacterized protein
STRINGGRMZM2G163641_P011e-157(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP107003542
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-57overexpressor of cationic peroxidase 3